Tropomodulin 1 (TMOD1) (NM_003275) Human Mass Spec Standard

CAT#: PH301134

TMOD1 MS Standard C13 and N15-labeled recombinant protein (NP_003266)

Product Images

Coomassie blue staining of purified TMOD1 protein (Cat# TP301134). The protein was produced from HEK293T cells transfected with TMOD1 cDNA clone (Cat# RC201134) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201134
• Predicted MW: 40.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201134 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSYRRELEKYRDLDEDKILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTGPFKREELLDH
  LEKQAKEFKDREDLVPYTGEKRGKVWVPKQKPLDPVLESVTLEPELEEALANASDAELCDIAAILGMHTL
  MSNQQYYQALSSSSIMNKEGLNSVIKPTQYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPI
  PTLKAYAEALKENSYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNT
  SLVEMKIDNQSQPLGNKVEMEIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTGP
  IIPKCRSGV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003266
• RefSeq Size: 3352
• RefSeq ORF: 1077
• Synonyms: D9S57E; ETMOD; TMOD
• Locus ID: 7111
• UniProt ID: P28289
• Cytogenetics: 9q22.33
• Summary: 'This gene encodes a member of the tropomodulin family. The encoded protein is an actin-capping protein that regulates tropomyosin by binding to its N-terminus, inhibiting depolymerization and elongation of the pointed end of actin filaments and thereby influencing the structure of the erythrocyte membrane skeleton. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Oct 2009]'