Tropomodulin 1 (TMOD1) (NM_003275) Human Recombinant Protein
CAT#: TP301134
Recombinant protein of human tropomodulin 1 (TMOD1)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201134 protein sequence
Red=Cloning site Green=Tags(s) MSYRRELEKYRDLDEDKILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTGPFKREELLDH LEKQAKEFKDREDLVPYTGEKRGKVWVPKQKPLDPVLESVTLEPELEEALANASDAELCDIAAILGMHTL MSNQQYYQALSSSSIMNKEGLNSVIKPTQYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPI PTLKAYAEALKENSYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNT SLVEMKIDNQSQPLGNKVEMEIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTGP IIPKCRSGV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 40.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003266 |
Locus ID | 7111 |
UniProt ID | P28289 |
Cytogenetics | 9q22.33 |
Refseq Size | 3352 |
Refseq ORF | 1077 |
Synonyms | D9S57E; ETMOD; TMOD |
Summary | This gene encodes a member of the tropomodulin family. The encoded protein is an actin-capping protein that regulates tropomyosin by binding to its N-terminus, inhibiting depolymerization and elongation of the pointed end of actin filaments and thereby influencing the structure of the erythrocyte membrane skeleton. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Oct 2009] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418797 | TMOD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431319 | TMOD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418797 | Transient overexpression lysate of tropomodulin 1 (TMOD1), transcript variant 1 |
USD 396.00 |
|
LY431319 | Transient overexpression lysate of tropomodulin 1 (TMOD1), transcript variant 2 |
USD 396.00 |
|
PH301134 | TMOD1 MS Standard C13 and N15-labeled recombinant protein (NP_003266) |
USD 2,055.00 |
|
TP328291 | Recombinant protein of human tropomodulin 1 (TMOD1), transcript variant 2. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review