MTH1 (NUDT1) (NM_198952) Human Mass Spec Standard
CAT#: PH301148
NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945190)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201148 |
| Predicted MW | 20.3 kDa |
| Protein Sequence |
>RC201148 protein sequence
Red=Cloning site Green=Tags(s) MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIED GARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMW PDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_945190 |
| RefSeq Size | 813 |
| RefSeq ORF | 537 |
| Synonyms | MTH1 |
| Locus ID | 4521 |
| UniProt ID | P36639, A0A024R858 |
| Cytogenetics | 7p22.3 |
| Summary | 'Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A rare single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described. [provided by RefSeq, Dec 2018]' |
| Protein Families | Stem cell - Pluripotency |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404632 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC404633 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC404634 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC404636 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC404637 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC419314 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429104 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC430775 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC430776 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC430778 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC430779 | NUDT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY404632 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 2A |
USD 436.00 |
|
| LY404633 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 2B |
USD 436.00 |
|
| LY404634 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 3A |
USD 436.00 |
|
| LY404636 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 4A |
USD 436.00 |
|
| LY404637 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 4B |
USD 436.00 |
|
| LY419314 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 1 |
USD 436.00 |
|
| LY429104 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 1 |
USD 396.00 |
|
| LY430775 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 2B |
USD 396.00 |
|
| LY430776 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 3A |
USD 396.00 |
|
| LY430778 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 4A |
USD 396.00 |
|
| LY430779 | Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 4B |
USD 396.00 |
|
| PH308551 | NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_002443) |
USD 2,055.00 |
|
| PH312655 | NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945186) |
USD 2,055.00 |
|
| PH312705 | NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945187) |
USD 2,055.00 |
|
| PH312761 | NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945188) |
USD 2,055.00 |
|
| PH312808 | NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945191) |
USD 2,055.00 |
|
| TP301148 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 3B |
USD 823.00 |
|
| TP308551 | Purified recombinant protein of Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 1 |
USD 823.00 |
|
| TP312655 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 2A |
USD 823.00 |
|
| TP312705 | Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 2B |
USD 823.00 |
|
| TP312761 | Purified recombinant protein of Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 3A |
USD 748.00 |
|
| TP312808 | Purified recombinant protein of Homo sapiens nudix (nucleoside diphosphate linked moiety X)-type motif 1 (NUDT1), transcript variant 4A |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China