MTH1 (NUDT1) (NM_198950) Human Mass Spec Standard

CAT#: PH312761

NUDT1 MS Standard C13 and N15-labeled recombinant protein (NP_945188)

Product Images

Coomassie blue staining of purified NUDT1 protein (Cat# TP312761). The protein was produced from HEK293T cells transfected with NUDT1 cDNA clone (Cat# RC212761) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC212761
• Predicted MW: 17.8 kDa
• Protein Sequence:
  Sequence Link

  >RC212761 representing NM_198950
  Red=Cloning site Green=Tags(s)
  
  MGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQI
  VFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQ
  GQDTILDYTLREVDTV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_945188
• RefSeq Size: 740
• RefSeq ORF: 468
• Synonyms: MTH1
• Locus ID: 4521
• UniProt ID: P36639, A0A024R819
• Cytogenetics: 7p22.3
• Summary: 'Misincorporation of oxidized nucleoside triphosphates into DNA/RNA during replication and transcription can cause mutations that may result in carcinogenesis or neurodegeneration. The protein encoded by this gene is an enzyme that hydrolyzes oxidized purine nucleoside triphosphates, such as 8-oxo-dGTP, 8-oxo-dATP, 2-hydroxy-dATP, and 2-hydroxy rATP, to monophosphates, thereby preventing misincorporation. The encoded protein is localized mainly in the cytoplasm, with some in the mitochondria, suggesting that it is involved in the sanitization of nucleotide pools both for nuclear and mitochondrial genomes. Several alternatively spliced transcript variants, some of which encode distinct isoforms, have been identified. Additional variants have been observed, but their full-length natures have not been determined. A rare single-nucleotide polymorphism that results in the production of an additional, longer isoform (p26) has been described. [provided by RefSeq, Dec 2018]'
• Protein Families: Stem cell - Pluripotency