CDK4 (NM_000075) Human Mass Spec Standard
CAT#: PH301156
CDK4 MS Standard C13 and N15-labeled recombinant protein (NP_000066)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201156 |
| Predicted MW | 33.7 kDa |
| Protein Sequence |
>RC201156 protein sequence
Red=Cloning site Green=Tags(s) MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPN VVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRD LKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRR KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNP HKRISAFRALQHSYLHKDEGNPE myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000066 |
| RefSeq Size | 2020 |
| RefSeq ORF | 909 |
| Synonyms | CMM3; PSK-J3 |
| Locus ID | 1019 |
| UniProt ID | P11802, A0A024RBB6 |
| Cytogenetics | 12q14.1 |
| Summary | 'The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is highly similar to the gene products of S. cerevisiae cdc28 and S. pombe cdc2. It is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression. The activity of this kinase is restricted to the G1-S phase, which is controlled by the regulatory subunits D-type cyclins and CDK inhibitor p16(INK4a). This kinase was shown to be responsible for the phosphorylation of retinoblastoma gene product (Rb). Mutations in this gene as well as in its related proteins including D-type cyclins, p16(INK4a) and Rb were all found to be associated with tumorigenesis of a variety of cancers. Multiple polyadenylation sites of this gene have been reported. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Bladder cancer, Cell cycle, Chronic myeloid leukemia, Glioma, Melanoma, Non-small cell lung cancer, p53 signaling pathway, Pancreatic cancer, Pathways in cancer, Small cell lung cancer, T cell receptor signaling pathway, Tight junction |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400021 | CDK4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400021 | Transient overexpression lysate of cyclin-dependent kinase 4 (CDK4) |
USD 436.00 |
|
| TP301156 | Recombinant protein of human cyclin-dependent kinase 4 (CDK4) |
USD 823.00 |
|
| TP720874 | Purified recombinant protein of Human cyclin-dependent kinase 4 (CDK4) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China