TIP49A (RUVBL1) (NM_003707) Human Mass Spec Standard

CAT#: PH301170

RUVBL1 MS Standard C13 and N15-labeled recombinant protein (NP_003698)

Product Images

Coomassie blue staining of purified RUVBL1 protein (Cat# TP301170). The protein was produced from HEK293T cells transfected with RUVBL1 cDNA clone (Cat# RC201170) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201170
• Predicted MW: 50.2 kDa
• Protein Sequence:
  Sequence Link

  >RC201170 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAG
  PPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTP
  CETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYA
  TEFDLEAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEIN
  KVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGI
  PLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKIN
  GKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003698
• RefSeq Size: 1785
• RefSeq ORF: 1368
• Synonyms: ECP-54; ECP54; INO80H; NMP 238; NMP238; PONTIN; Pontin52; RVB1; TIH1; TIP49; TIP49A
• Locus ID: 8607
• UniProt ID: Q9Y265, A0A384MTR5
• Cytogenetics: 3q21.3
• Summary: This gene encodes a protein that has both DNA-dependent ATPase and DNA helicase activities and belongs to the ATPases associated with diverse cellular activities (AAA+) protein family. The encoded protein associates with several multisubunit transcriptional complexes and with protein complexes involved in both ATP-dependent remodeling and histone modification. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
• Protein Families: Stem cell - Pluripotency, Transcription Factors
• Protein Pathways: Wnt signaling pathway