VTI1B (NM_006370) Human Mass Spec Standard

CAT#: PH301172

VTI1B MS Standard C13 and N15-labeled recombinant protein (NP_006361)

Product Images

Coomassie blue staining of purified VTI1B protein (Cat# TP301172). The protein was produced from HEK293T cells transfected with VTI1B cDNA clone (Cat# RC201172) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201172
• Predicted MW: 26.7 kDa
• Protein Sequence:
  Sequence Link

  >RC201172 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASSAASSEHFEKLHEIFRGLHEDLQGVPERLLGTAGTEEKKKLIRDFDEKQQEANETLAEMEEELRYAP
  LSFRNPMMSKLRNYRKDLAKLHREVRSTPLTATPGGRGDMKYGIYAVENEHMNRLQSQRAMLLQGTESLN
  RATQSIERSHRIATETDQIGSEIIEELGEQRDQLERTKSRLVNTSENLSKSRKILRSMSRKVTTNKLLLS
  IIILLELAILGGLVYYKFFRSH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006361
• RefSeq Size: 1357
• RefSeq ORF: 696
• Synonyms: v-SNARE; VTI1; VTI1-LIKE; vti1-rp1; VTI1L; VTI2
• Locus ID: 10490
• UniProt ID: Q9UEU0
• Cytogenetics: 14q24.1
• Summary: V-SNARE that mediates vesicle transport pathways through interactions with t-SNAREs on the target membrane. These interactions are proposed to mediate aspects of the specificity of vesicle trafficking and to promote fusion of the lipid bilayers. May be concerned with increased secretion of cytokines associated with cellular senescence. [UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport