ZNF205 (NM_001042428) Human Mass Spec Standard
CAT#: PH301174
ZNF205 MS Standard C13 and N15-labeled recombinant protein (NP_001035893)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201174 |
Predicted MW | 60.6 kDa |
Protein Sequence |
>RC201174 protein sequence
Red=Cloning site Green=Tags(s) MSADGGGIQDTQDKETPPEVPDRGHPHQEMPSKLGEAVPSGDAQESLHIKMEPEEPHSEGASQEDGAQGA WGWAPLSHGSKEKALFLPGGALPSPRIPVLSREGRTRDRQMAAALLTAWSQMPVTFEDVALYLSREEWGR LDHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHGKGEASGSSRQAGDEKEWRGACTGAVEVGQRVQTS SVAALGNVKPFRTRAGRVQWGVPQCAQEAACGRSSGPAKDSGQPAEPDRTPDAAPPDPSPTEPQEYRVPE KPNEEEKGAPESGEEGLAPDSEVGRKSYRCEQCGKGFSWHSHLVTHRRTHTGEKPYACTDCGKRFGRSSH LIQHQIIHTGEKPYTCPACRKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTRRSDLVTHQGTHTGAKPH KCPICAKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLDCGKSFSHSSH LTAHQRTHRGVRPYACPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGAAAAGALATPPPAPT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001035893 |
RefSeq Size | 2009 |
RefSeq ORF | 1662 |
Synonyms | RhitH; Zfp13; ZNF210 |
Locus ID | 7755 |
UniProt ID | O95201 |
Cytogenetics | 16p13.3 |
Summary | May be involved in transcriptional regulation. [UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418666 | ZNF205 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420898 | ZNF205 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425738 | ZNF205 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418666 | Transient overexpression lysate of zinc finger protein 205 (ZNF205), transcript variant 1 |
USD 396.00 |
|
LY420898 | Transient overexpression lysate of zinc finger protein 205 (ZNF205), transcript variant 2 |
USD 396.00 |
|
LY425738 | Transient overexpression lysate of zinc finger protein 205 (ZNF205), transcript variant 2 |
USD 396.00 |
|
PH314738 | ZNF205 MS Standard C13 and N15-labeled recombinant protein (NP_003447) |
USD 2,055.00 |
|
TP301174 | Purified recombinant protein of Homo sapiens zinc finger protein 205 (ZNF205), transcript variant 2 |
USD 823.00 |
|
TP314738 | Purified recombinant protein of Homo sapiens zinc finger protein 205 (ZNF205), transcript variant 1 |
USD 748.00 |
|
TP761639 | Purified recombinant protein of Human zinc finger protein 205 (ZNF205), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review