CDK2AP2 (NM_005851) Human Mass Spec Standard

CAT#: PH301178

CDK2AP2 MS Standard C13 and N15-labeled recombinant protein (NP_005842)

Product Images

Coomassie blue staining of purified CDK2AP2 protein (Cat# TP301178). The protein was produced from HEK293T cells transfected with CDK2AP2 cDNA clone (Cat# RC201178) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201178
• Predicted MW: 13.1 kDa
• Protein Sequence:
  Sequence Link

  >RC201178 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGS
  QSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005842
• RefSeq Size: 1499
• RefSeq ORF: 378
• Synonyms: DOC-1R; p14
• Locus ID: 10263
• UniProt ID: O75956, Q6IAV4
• Cytogenetics: 11q13.2
• Summary: This gene encodes a protein that interacts with cyclin-dependent kinase 2 associated protein 1. Pseudogenes associated with this gene are located on chromosomes 7 and 9. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2012]