CDK2AP2 (NM_005851) Human Recombinant Protein
CAT#: TP301178
Recombinant protein of human cyclin-dependent kinase 2 associated protein 2 (CDK2AP2)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201178 protein sequence
Red=Cloning site Green=Tags(s) MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGS QSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 12.9 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005842 |
| Locus ID | 10263 |
| UniProt ID | O75956, Q6IAV4 |
| Cytogenetics | 11q13.2 |
| Refseq Size | 1499 |
| Refseq ORF | 378 |
| Synonyms | DOC-1R; p14 |
| Summary | This gene encodes a protein that interacts with cyclin-dependent kinase 2 associated protein 1. Pseudogenes associated with this gene are located on chromosomes 7 and 9. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2012] |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417039 | CDK2AP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY417039 | Transient overexpression lysate of cyclin-dependent kinase 2 associated protein 2 (CDK2AP2) |
USD 436.00 |
|
| PH301178 | CDK2AP2 MS Standard C13 and N15-labeled recombinant protein (NP_005842) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China