CDK2AP2 (NM_005851) Human Recombinant Protein

CAT#: TP301178

Recombinant protein of human cyclin-dependent kinase 2 associated protein 2 (CDK2AP2)

Product Images

Coomassie blue staining of purified CDK2AP2 protein (Cat# TP301178). The protein was produced from HEK293T cells transfected with CDK2AP2 cDNA clone (Cat# RC201178) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201178 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGS
  QSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005842
• Locus ID: 10263
• UniProt ID: O75956, Q6IAV4
• Cytogenetics: 11q13.2
• Refseq Size: 1499
• Refseq ORF: 378
• Synonyms: DOC-1R; p14
• Summary: This gene encodes a protein that interacts with cyclin-dependent kinase 2 associated protein 1. Pseudogenes associated with this gene are located on chromosomes 7 and 9. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2012]