Cyclin (CCNI) (NM_006835) Human Mass Spec Standard

CAT#: PH301186

CCNI MS Standard C13 and N15-labeled recombinant protein (NP_006826)

Product Images

Coomassie blue staining of purified CCNI protein (Cat# TP301186). The protein was produced from HEK293T cells transfected with CCNI cDNA clone (Cat# RC201186) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201186
• Predicted MW: 42.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201186 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKFPGPLENQRLSFLLEKAITREAQMWKVNVRKMPSNQNVSPSQRDEVIQWLAKLKYQFNLYPETFALAS
  SLLDRFLATVKAHPKYLSCIAISCFFLAAKTVEEDERIPVLKVLARDSFCGCSSSEILRMERIILDKLNW
  DLHTATPLDFLHIFHAIAVSTRPQLLFSLPKLSPSQHLAVLTKQLLHCMACNQLLQFRGSMLALAMVSLE
  MEKLIPDWLSLTIELLQKAQMDSSQLIHCRELVAHHLSTLQSSLPLNSVYVYRPLKHTLVTCDKGVFRLH
  PSSVPGPDFSKDNSKPEVPVRGTAAFYHHLPAASGCKQTSTKRKVEEMEVDDFYDGIKRLYNEDNVSENV
  GSVCGTDLSRQEGHASPCPPLQPVSVM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006826
• RefSeq Size: 1890
• RefSeq ORF: 1131
• Synonyms: CCNI1; CYC1; CYI
• Locus ID: 10983
• UniProt ID: Q14094, A0A024RDH0
• Cytogenetics: 4q21.1
• Summary: The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin shows the highest similarity with cyclin G. The transcript of this gene was found to be expressed constantly during cell cycle progression. [provided by RefSeq, Jan 2017]