APE1 (APEX1) (NM_080648) Human Mass Spec Standard

CAT#: PH301208

APEX1 MS Standard C13 and N15-labeled recombinant protein (NP_542379)

Product Images

Coomassie blue staining of purified APEX1 protein (Cat# TP301208). The protein was produced from HEK293T cells transfected with APEX1 cDNA clone (Cat# RC201208) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201208
• Predicted MW: 35.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201208 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVD
  GLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPL
  KVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGD
  LNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGW
  RLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_542379
• RefSeq Size: 1497
• RefSeq ORF: 954
• Synonyms: APE; APE1; APEN; APEX; APX; HAP1; REF1
• Locus ID: 328
• UniProt ID: P27695, Q5TZP7
• Cytogenetics: 14q11.2
• Summary: 'The APEX gene encodes the major AP endonuclease in human cells. It encodes the APEX endonuclease, a DNA repair enzyme with apurinic/apyrimidinic (AP) activity. Such AP activity sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. The AP sites are the most frequent pre-mutagenic lesions that can prevent normal DNA replication. Splice variants have been found for this gene; all encode the same protein. Disruptions in the biological functions related to APEX are associated with many various malignancies and neurodegenerative diseases.[provided by RefSeq, Dec 2019]'
• Protein Families: Druggable Genome, Stem cell - Pluripotency, Transcription Factors
• Protein Pathways: Base excision repair