Neurogranin (NRGN) (NM_006176) Human Mass Spec Standard
CAT#: PH301209
NRGN MS Standard C13 and N15-labeled recombinant protein (NP_006167)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201209 |
| Predicted MW | 7.6 kDa |
| Protein Sequence |
>RC201209 protein sequence
Red=Cloning site Green=Tags(s) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGG AGGGPSGD myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_006167 |
| RefSeq Size | 1235 |
| RefSeq ORF | 234 |
| Synonyms | hng; RC3 |
| Locus ID | 4900 |
| UniProt ID | Q92686, A0A024R3M7 |
| Cytogenetics | 11q24.2 |
| Summary | 'Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416815 | NRGN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC426667 | NRGN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY416815 | Transient overexpression lysate of neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1 |
USD 436.00 |
|
| LY426667 | Transient overexpression lysate of neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 2 |
USD 436.00 |
|
| PH324996 | NRGN MS Standard C13 and N15-labeled recombinant protein (NP_001119653) |
USD 2,055.00 |
|
| TP301209 | Recombinant protein of human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1 |
USD 823.00 |
|
| TP324996 | Recombinant protein of human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China