Neurogranin (NRGN) (NM_006176) Human Mass Spec Standard

CAT#: PH301209

NRGN MS Standard C13 and N15-labeled recombinant protein (NP_006167)

Product Images

Coomassie blue staining of purified NRGN protein (Cat# TP301209). The protein was produced from HEK293T cells transfected with NRGN cDNA clone (Cat# RC201209) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201209
• Predicted MW: 7.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201209 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGG
  AGGGPSGD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006167
• RefSeq Size: 1235
• RefSeq ORF: 234
• Synonyms: hng; RC3
• Locus ID: 4900
• UniProt ID: Q92686, A0A024R3M7
• Cytogenetics: 11q24.2
• Summary: 'Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome