Neurogranin (NRGN) (NM_006176) Human Recombinant Protein
CAT#: TP301209
Recombinant protein of human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1
View other "NRGN" proteins (7)
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 447.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201209 protein sequence
Red=Cloning site Green=Tags(s) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGG AGGGPSGD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 7.4 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Bioactivity | ELISA standard (PMID: 29250027) |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006167 |
| Locus ID | 4900 |
| UniProt ID | Q92686, A0A024R3M7 |
| Cytogenetics | 11q24.2 |
| Refseq Size | 1235 |
| Refseq ORF | 234 |
| Synonyms | hng; RC3 |
| Summary | Neurogranin (NRGN) is the human homolog of the neuron-specific rat RC3/neurogranin gene. This gene encodes a postsynaptic protein kinase substrate that binds calmodulin in the absence of calcium. The NRGN gene contains four exons and three introns. The exons 1 and 2 encode the protein and exons 3 and 4 contain untranslated sequences. It is suggested that the NRGN is a direct target for thyroid hormone in human brain, and that control of expression of this gene could underlay many of the consequences of hypothyroidism on mental states during development as well as in adult subjects. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416815 | NRGN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC426667 | NRGN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY416815 | Transient overexpression lysate of neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 1 |
USD 436.00 |
|
| LY426667 | Transient overexpression lysate of neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 2 |
USD 436.00 |
|
| PH301209 | NRGN MS Standard C13 and N15-labeled recombinant protein (NP_006167) |
USD 2,055.00 |
|
| PH324996 | NRGN MS Standard C13 and N15-labeled recombinant protein (NP_001119653) |
USD 2,055.00 |
|
| TP324996 | Recombinant protein of human neurogranin (protein kinase C substrate, RC3) (NRGN), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China