CRIP1 (NM_001311) Human Mass Spec Standard

CAT#: PH301217

CRIP1 MS Standard C13 and N15-labeled recombinant protein (NP_001302)

Product Images

Coomassie blue staining of purified CRIP1 protein (Cat# TP301217). The protein was produced from HEK293T cells transfected with CRIP1 cDNA clone (Cat# RC201217) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201217
• Predicted MW: 8.5 kDa
• Protein Sequence:
  Sequence Link

  >RC201217 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGG
  AESHTFK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001302
• RefSeq Size: 480
• RefSeq ORF: 231
• Synonyms: CRHP; CRIP; CRP-1; CRP1
• Locus ID: 1396
• UniProt ID: P50238
• Cytogenetics: 14q32.33
• Summary: 'Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1; MIM 123876), rhombotin-1 (RBTN1; MIM 186921), rhombotin-2 (RBTN2; MIM 180385), and rhombotin-3 (RBTN3; MIM 180386). CRIP may be involved in intestinal zinc transport (Hempe and Cousins, 1991 [PubMed 1946385]).[supplied by OMIM, Mar 2008]'