CRIP1 (NM_001311) Human Recombinant Protein

CAT#: TP301217

Recombinant protein of human cysteine-rich protein 1 (intestinal) (CRIP1)

Product Images

Coomassie blue staining of purified CRIP1 protein (Cat# TP301217). The protein was produced from HEK293T cells transfected with CRIP1 cDNA clone (Cat# RC201217) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201217 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGG
  AESHTFK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 8.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001302
• Locus ID: 1396
• UniProt ID: P50238
• Cytogenetics: 14q32.33
• Refseq Size: 480
• Refseq ORF: 231
• Synonyms: CRHP; CRIP; CRP-1; CRP1
• Summary: Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1; MIM 123876), rhombotin-1 (RBTN1; MIM 186921), rhombotin-2 (RBTN2; MIM 180385), and rhombotin-3 (RBTN3; MIM 180386). CRIP may be involved in intestinal zinc transport (Hempe and Cousins, 1991 [PubMed 1946385]).[supplied by OMIM, Mar 2008]