CD20 (MS4A1) (NM_021950) Human Mass Spec Standard

CAT#: PH301242

MS4A1 MS Standard C13 and N15-labeled recombinant protein (NP_068769)

Product Images

Coomassie blue staining of purified MS4A1 protein (Cat# TP301242). The protein was produced from HEK293T cells transfected with MS4A1 cDNA clone (Cat# RC201242) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201242
• Predicted MW: 33.1 kDa
• Protein Sequence:
  Sequence Link

  >RC201242 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESKTLGAVQIMNGLFHIALGGLL
  MIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILN
  IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIFAFFQELVIAG
  IVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFP
  EPPQDQESSPIENDSSP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_068769
• RefSeq Size: 3331
• RefSeq ORF: 891
• Synonyms: B1; Bp35; CD20; CVID5; LEU-16; MS4A2; S7
• Locus ID: 931
• UniProt ID: P11836, A0A024R507
• Cytogenetics: 11q12.2
• Summary: 'This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Hematopoietic cell lineage