CD20 (MS4A1) (NM_021950) Human Recombinant Protein
CAT#: TP301242
Recombinant protein of human membrane-spanning 4-domains, subfamily A, member 1 (MS4A1), transcript variant 3
View other "MS4A1" proteins (6)
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 447.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201242 protein sequence
Red=Cloning site Green=Tags(s) MTTPRNSVNGTFPAEPMKGPIAMQSGPKPLFRRMSSLVGPTQSFFMRESKTLGAVQIMNGLFHIALGGLL MIPAGIYAPICVTVWYPLWGGIMYIISGSLLAATEKNSRKCLVKGKMIMNSLSLFAAISGMILSIMDILN IKISHFLKMESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCYSIQSLFLGILSVMLIFAFFQELVIAG IVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFP EPPQDQESSPIENDSSP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 32.9 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_068769 |
| Locus ID | 931 |
| UniProt ID | P11836, A0A024R507 |
| Cytogenetics | 11q12.2 |
| Refseq Size | 3331 |
| Refseq ORF | 891 |
| Synonyms | B1; Bp35; CD20; CVID5; FMC7; LEU-16; MS4A2; S7 |
| Summary | This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | Hematopoietic cell lineage |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402889 | MS4A1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC407182 | MS4A1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
| LY402889 | Transient overexpression lysate of membrane-spanning 4-domains, subfamily A, member 1 (MS4A1), transcript variant 3 |
USD 436.00 |
|
| LY407182 | Transient overexpression lysate of membrane-spanning 4-domains, subfamily A, member 1 (MS4A1), transcript variant 1 |
USD 436.00 |
|
| PH301242 | MS4A1 MS Standard C13 and N15-labeled recombinant protein (NP_068769) |
USD 2,055.00 |
|
| TP790190 | Purified recombinant protein of Human membrane-spanning 4-domains, subfamily A, member 1 (MS4A1), transcript variant 3, Ile141-Ser188, with N-terminal TrxA tag, expressed in E.coli, 50ug |
USD 205.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China