EIF1 (NM_005801) Human Mass Spec Standard

CAT#: PH301271

EIF1 MS Standard C13 and N15-labeled recombinant protein (NP_005792)

Product Images

Coomassie blue staining of purified EIF1 protein (Cat# TP301271). The protein was produced from HEK293T cells transfected with EIF1 cDNA clone (Cat# RC201271) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201271
• Predicted MW: 12.7 kDa
• Protein Sequence:
  Sequence Link

  >RC201271 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN
  GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005792
• RefSeq Size: 1326
• RefSeq ORF: 339
• Synonyms: A121; EIF-1; EIF1A; ISO1; SUI1
• Locus ID: 10209
• UniProt ID: P41567, Q6IAV3
• Cytogenetics: 17q21.2
• Summary: Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA. [UniProtKB/Swiss-Prot Function]