EIF1 (NM_005801) Human Recombinant Protein
CAT#: TP301271
Recombinant protein of human eukaryotic translation initiation factor 1 (EIF1)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201271 protein sequence
Red=Cloning site Green=Tags(s) MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACN GTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 12.6 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005792 |
| Locus ID | 10209 |
| UniProt ID | P41567, Q6IAV3 |
| Cytogenetics | 17q21.2 |
| Refseq Size | 1326 |
| Refseq ORF | 339 |
| Synonyms | A121; EIF-1; EIF1A; ISO1; SUI1 |
| Summary | Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401762 | EIF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401762 | Transient overexpression lysate of eukaryotic translation initiation factor 1 (EIF1) |
USD 436.00 |
|
| PH301271 | EIF1 MS Standard C13 and N15-labeled recombinant protein (NP_005792) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China