M6PR (NM_002355) Human Mass Spec Standard

CAT#: PH301277

M6PR MS Standard C13 and N15-labeled recombinant protein (NP_002346)

Product Images

Coomassie blue staining of purified M6PR protein (Cat# TP301277). The protein was produced from HEK293T cells transfected with M6PR cDNA clone (Cat# RC201277) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201277
• Predicted MW: 31 kDa
• Protein Sequence:
  Sequence Link

  >RC201277 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVKRLKPLFNKSFESTVGQGSDT
  YIYIFRVCREAGNHTSGAGLVQINKSNGKETVVGRLNETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAV
  VMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACSPEISHLSVGSILLVTFASLVAVYVVGGFLY
  QRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002346
• RefSeq Size: 2583
• RefSeq ORF: 831
• Synonyms: CD-M6PR; CD-MPR; MPR-46; MPR 46; MPR46; SMPR
• Locus ID: 4074
• UniProt ID: P20645
• Cytogenetics: 12p13.31
• Summary: 'This gene encodes a member of the P-type lectin family. P-type lectins play a critical role in lysosome function through the specific transport of mannose-6-phosphate-containing acid hydrolases from the Golgi complex to lysosomes. The encoded protein functions as a homodimer and requires divalent cations for ligand binding. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome X. [provided by RefSeq, May 2011]'
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Lysosome