M6PR (NM_002355) Human Recombinant Protein

CAT#: TP301277

Recombinant protein of human mannose-6-phosphate receptor (cation dependent) (M6PR)

Product Images

Coomassie blue staining of purified M6PR protein (Cat# TP301277). The protein was produced from HEK293T cells transfected with M6PR cDNA clone (Cat# RC201277) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201277 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFPFYSCWRTGLLLLLLAVAVRESWQTEEKTCDLVGEKGKESEKELALVKRLKPLFNKSFESTVGQGSDT
  YIYIFRVCREAGNHTSGAGLVQINKSNGKETVVGRLNETHIFNGSNWIMLIYKGGDEYDNHCGKEQRRAV
  VMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLACSPEISHLSVGSILLVTFASLVAVYVVGGFLY
  QRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002346
• Locus ID: 4074
• UniProt ID: P20645
• Cytogenetics: 12p13.31
• Refseq Size: 2583
• Refseq ORF: 831
• Synonyms: CD-M6PR; CD-MPR; MPR-46; MPR 46; MPR46; SMPR
• Summary: This gene encodes a member of the P-type lectin family. P-type lectins play a critical role in lysosome function through the specific transport of mannose-6-phosphate-containing acid hydrolases from the Golgi complex to lysosomes. The encoded protein functions as a homodimer and requires divalent cations for ligand binding. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome X. [provided by RefSeq, May 2011]
• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Lysosome