PAFAH1B2 (NM_002572) Human Mass Spec Standard

CAT#: PH301313

PAFAH1B2 MS Standard C13 and N15-labeled recombinant protein (NP_002563)

Product Images

Coomassie blue staining of purified PAFAH1B2 protein (Cat# TP301313). The protein was produced from HEK293T cells transfected with PAFAH1B2 cDNA clone (Cat# RC201313) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201313
• Predicted MW: 25.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201313 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALN
  FGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLL
  PRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLH
  ELIMQLLEETPEEKQTTIA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002563
• RefSeq Size: 4200
• RefSeq ORF: 687
• Synonyms: HEL-S-303
• Locus ID: 5049
• UniProt ID: P68402, V9HW44
• Cytogenetics: 11q23.3
• Summary: 'Platelet-activating factor acetylhydrolase (PAFAH) inactivates platelet-activating factor (PAF) into acetate and LYSO-PAF. This gene encodes the beta subunit of PAFAH, the other subunits are alpha and gamma. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jan 2014]'
• Protein Pathways: Ether lipid metabolism, Metabolic pathways