C20orf4 (AAR2) (NM_015511) Human Mass Spec Standard

CAT#: PH301316

C20orf4 MS Standard C13 and N15-labeled recombinant protein (NP_056326)

Product Images

Coomassie blue staining of purified AAR2 protein (Cat# TP301316). The protein was produced from HEK293T cells transfected with AAR2 cDNA clone (Cat# RC201316) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201316
• Predicted MW: 43.5 kDa
• Protein Sequence:
  Sequence Link

  >RC201316 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAVQMDPELAKRLFFEGATVVILNMPKGTEFGIDYNSWEVGPKFRGVKMIPPGIHFLHYSSVDKANPKE
  VGPRMGFFLSLHQRGLTVLRWSTLREEVDLSPAPESEVEAMRANLQELDQFLGPYPYATLKKWISLTNFI
  SEATVEKLQPENRQICAFSDVLPVLSMKHTKDRVGQNLPRCGIECKSYQEGLARLPEMKPRAGTEIRFSE
  LPTQMFPEGATPAEITKHSMDLSYALETVLNKQFPSSPQDVLGELQFAFVCFLLGNVYEAFEHWKRLLNL
  LCRSEAAMMKHHTLYINLISILYHQLGEIPADFFVDIVSQDNFLTSTLQVFFSSACSIAVDATLRKKAEK
  FQAHLTKKFRWDFAAEPEDCAPVVVELPEGIEMG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056326
• RefSeq Size: 2765
• RefSeq ORF: 1152
• Synonyms: C20orf4; CGI-23
• Locus ID: 25980
• UniProt ID: Q9Y312
• Cytogenetics: 20q11.23
• Summary: This gene encodes the homolog of the yeast A1-alpha2 repressin protein that is involved in mRNA splicing. Alternately spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2012]