C20orf4 (AAR2) (NM_015511) Human Recombinant Protein

CAT#: TP301316

Recombinant protein of human chromosome 20 open reading frame 4 (C20orf4)

Product Images

Coomassie blue staining of purified AAR2 protein (Cat# TP301316). The protein was produced from HEK293T cells transfected with AAR2 cDNA clone (Cat# RC201316) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201316 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAVQMDPELAKRLFFEGATVVILNMPKGTEFGIDYNSWEVGPKFRGVKMIPPGIHFLHYSSVDKANPKE
  VGPRMGFFLSLHQRGLTVLRWSTLREEVDLSPAPESEVEAMRANLQELDQFLGPYPYATLKKWISLTNFI
  SEATVEKLQPENRQICAFSDVLPVLSMKHTKDRVGQNLPRCGIECKSYQEGLARLPEMKPRAGTEIRFSE
  LPTQMFPEGATPAEITKHSMDLSYALETVLNKQFPSSPQDVLGELQFAFVCFLLGNVYEAFEHWKRLLNL
  LCRSEAAMMKHHTLYINLISILYHQLGEIPADFFVDIVSQDNFLTSTLQVFFSSACSIAVDATLRKKAEK
  FQAHLTKKFRWDFAAEPEDCAPVVVELPEGIEMG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 43.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056326
• Locus ID: 25980
• UniProt ID: Q9Y312
• Cytogenetics: 20q11.23
• Refseq Size: 2765
• Refseq ORF: 1152
• Synonyms: C20orf4; CGI-23
• Summary: This gene encodes the homolog of the yeast A1-alpha2 repressin protein that is involved in mRNA splicing. Alternately spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2012]