NR2F6 (NM_005234) Human Mass Spec Standard

CAT#: PH301336

NR2F6 MS Standard C13 and N15-labeled recombinant protein (NP_005225)

Product Images

Coomassie blue staining of purified NR2F6 protein (Cat# TP301336). The protein was produced from HEK293T cells transfected with NR2F6 cDNA clone (Cat# RC201336) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201336
• Predicted MW: 42.8 kDa
• Protein Sequence:
  Sequence Link

  >RC201336 representing NM_005234
  Red=Cloning site Green=Tags(s)
  
  MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV
  FTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVA
  ASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLL
  FSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMD
  QVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRF
  GRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005225
• RefSeq Size: 1804
• RefSeq ORF: 1212
• Synonyms: EAR-2; EAR2; ERBAL2
• Locus ID: 2063
• UniProt ID: P10588, F1D8R3
• Cytogenetics: 19p13.11
• Summary: ''
• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors