DOHH (NM_031304) Human Mass Spec Standard
CAT#: PH301340
DOHH MS Standard C13 and N15-labeled recombinant protein (NP_112594)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201340 |
Predicted MW | 32.7 kDa |
Protein Sequence |
>RC201340 representing NM_031304
Red=Cloning site Green=Tags(s) MVTEQEVDAIGQTLVDPKQPLQARFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAYCLGQMQDARA IPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAETCQLAVRRLEWLQQHGGEPA AGPYLSVDPAPPAEERDVGRLREALLDESRPLFERYRAMFALRNAGGEEAALALAEGLHCGSALFRHEVG YVLGQLQHEAAVPQLAAALARCTENPMVRHECAEALGAIARPACLAALQAHADDPERVVRESCEVALDMY EHETGRAFQYADGLEQLRGAPS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_112594 |
RefSeq Size | 1772 |
RefSeq ORF | 906 |
Synonyms | hDOHH; HLRC1 |
Locus ID | 83475 |
UniProt ID | Q9BU89 |
Cytogenetics | 19p13.3 |
Summary | This gene encodes a metalloenzyme that catalyzes the last step in the conversion of lysine to the unique amino acid hypusine in eukaryotic initiation factor 5A. The encoded protein hydroxylates deoxyhypusine to form hypusine in the mature eukaryotic initiation factor 5A protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2009] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410554 | DOHH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428737 | DOHH HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410554 | Transient overexpression lysate of deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 2 |
USD 396.00 |
|
LY428737 | Transient overexpression lysate of deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 1 |
USD 396.00 |
|
PH326938 | DOHH MS Standard C13 and N15-labeled recombinant protein (NP_001138637) |
USD 2,055.00 |
|
TP301340 | Recombinant protein of human deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 2 |
USD 823.00 |
|
TP326938 | Recombinant protein of human deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review