DOHH (NM_031304) Human Recombinant Protein

CAT#: TP301340

Recombinant protein of human deoxyhypusine hydroxylase/monooxygenase (DOHH), transcript variant 2

Product Images

Coomassie blue staining of purified DOHH protein (Cat# TP301340). The protein was produced from HEK293T cells transfected with DOHH cDNA clone (Cat# RC201340) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201340 representing NM_031304
  Red=Cloning site Green=Tags(s)
  
  MVTEQEVDAIGQTLVDPKQPLQARFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAYCLGQMQDARA
  IPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAETCQLAVRRLEWLQQHGGEPA
  AGPYLSVDPAPPAEERDVGRLREALLDESRPLFERYRAMFALRNAGGEEAALALAEGLHCGSALFRHEVG
  YVLGQLQHEAAVPQLAAALARCTENPMVRHECAEALGAIARPACLAALQAHADDPERVVRESCEVALDMY
  EHETGRAFQYADGLEQLRGAPS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_112594
• Locus ID: 83475
• UniProt ID: Q9BU89
• Cytogenetics: 19p13.3
• Refseq Size: 1772
• Refseq ORF: 906
• Synonyms: hDOHH; HLRC1
• Summary: This gene encodes a metalloenzyme that catalyzes the last step in the conversion of lysine to the unique amino acid hypusine in eukaryotic initiation factor 5A. The encoded protein hydroxylates deoxyhypusine to form hypusine in the mature eukaryotic initiation factor 5A protein. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Feb 2009]