DOHH (NM_001145165) Human Mass Spec Standard

CAT#: PH326938

DOHH MS Standard C13 and N15-labeled recombinant protein (NP_001138637)

Product Images

Coomassie blue staining of purified DOHH protein (Cat# TP326938). The protein was produced from HEK293T cells transfected with DOHH cDNA clone (Cat# RC226938) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC226938
• Predicted MW: 32.7 kDa
• Protein Sequence:
  Sequence Link

  >RC226938 representing NM_001145165
  Red=Cloning site Green=Tags(s)
  
  MVTEQEVDAIGQTLVDPKQPLQARFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAYCLGQMQDARA
  IPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAETCQLAVRRLEWLQQHGGEPA
  AGPYLSVDPAPPAEERDVGRLREALLDESRPLFERYRAMFALRNAGGEEAALALAEGLHCGSALFRHEVG
  YVLGQLQHEAAVPQLAAALARCTENPMVRHECAEALGAIARPACLAALQAHADDPERVVRESCEVALDMY
  EHETGRAFQYADGLEQLRGAPS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001138637
• RefSeq ORF: 906
• Synonyms: hDOHH; HLRC1
• Locus ID: 83475
• UniProt ID: Q9BU89
• Cytogenetics: 19p13.3
• Summary: This gene encodes a metalloenzyme that catalyzes the last step in the conversion of lysine to the unique amino acid hypusine in eukaryotic initiation factor 5A. The encoded protein hydroxylates deoxyhypusine to form hypusine in the mature eukaryotic initiation factor 5A protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2009]