RAB3C (NM_138453) Human Mass Spec Standard

CAT#: PH301436

RAB3C MS Standard C13 and N15-labeled recombinant protein (NP_612462)

Product Images

Coomassie blue staining of purified RAB3C protein (Cat# TP301436). The protein was produced from HEK293T cells transfected with RAB3C cDNA clone (Cat# RC201436) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201436
• Predicted MW: 26 kDa
• Protein Sequence:
  Sequence Link

  >RC201436 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVK
  TVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVIL
  VGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQ
  NTRLKETPPPPQPNCAC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_612462
• RefSeq Size: 1030
• RefSeq ORF: 681
• Synonyms: 2700062I01Rik; 3110015B08Rik; 3110037E15Rik; AI850886; MGC124069; RAB3C, member RAS oncogene family; small GTP-binding protein Rab3C
• Locus ID: 115827
• UniProt ID: Q96E17
• Cytogenetics: 5q11.2
• Summary: This gene is a member of the RAS oncogene family and encodes a small GTPase. Other similar small GTPases are known to be involved in vesicle trafficking, and the encoded protein was shown to play a role in recycling phagocytosed MHC class 1 complexes to the cell surface. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]
• Protein Families: Druggable Genome