RAB3C (NM_138453) Human Recombinant Protein
CAT#: TP301436
Recombinant protein of human RAB3C, member RAS oncogene family (RAB3C)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201436 protein sequence
Red=Cloning site Green=Tags(s) MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVK TVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVIL VGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQ NTRLKETPPPPQPNCAC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 25.8 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_612462 |
| Locus ID | 115827 |
| UniProt ID | Q96E17 |
| Cytogenetics | 5q11.2 |
| Refseq Size | 1030 |
| Refseq ORF | 681 |
| Summary | This gene is a member of the RAS oncogene family and encodes a small GTPase. Other similar small GTPases are known to be involved in vesicle trafficking, and the encoded protein was shown to play a role in recycling phagocytosed MHC class 1 complexes to the cell surface. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408603 | RAB3C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY408603 | Transient overexpression lysate of RAB3C, member RAS oncogene family (RAB3C) |
USD 436.00 |
|
| PH301436 | RAB3C MS Standard C13 and N15-labeled recombinant protein (NP_612462) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China