RAB3C (NM_138453) Human Recombinant Protein

CAT#: TP301436

Recombinant protein of human RAB3C, member RAS oncogene family (RAB3C)

Product Images

Coomassie blue staining of purified RAB3C protein (Cat# TP301436). The protein was produced from HEK293T cells transfected with RAB3C cDNA clone (Cat# RC201436) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201436 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVK
  TVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVIL
  VGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQ
  NTRLKETPPPPQPNCAC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_612462
• Locus ID: 115827
• UniProt ID: Q96E17
• Cytogenetics: 5q11.2
• Refseq Size: 1030
• Refseq ORF: 681
• Summary: This gene is a member of the RAS oncogene family and encodes a small GTPase. Other similar small GTPases are known to be involved in vesicle trafficking, and the encoded protein was shown to play a role in recycling phagocytosed MHC class 1 complexes to the cell surface. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]
• Protein Families: Druggable Genome