NDUFA5 (NM_005000) Human Mass Spec Standard

CAT#: PH301539

NDUFA5 MS Standard C13 and N15-labeled recombinant protein (NP_004991)

Product Images

Coomassie blue staining of purified NDUFA5 protein (Cat# TP301539). The protein was produced from HEK293T cells transfected with NDUFA5 cDNA clone (Cat# RC201539) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201539
• Predicted MW: 13.5 kDa
• Protein Sequence:
  Sequence Link

  >RC201539 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLED
  QLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004991
• RefSeq Size: 5602
• RefSeq ORF: 348
• Synonyms: B13; CI-13kB; CI-13KD-B; NUFM; UQOR13
• Locus ID: 4698
• UniProt ID: Q16718, A0A024R745
• Cytogenetics: 7q31.32
• Summary: 'This nuclear gene encodes a conserved protein that comprises the B13 subunit of complex I of the mitochondrial respiratory chain. The encoded protein localizes to the inner mitochondrial membrane, where it is thought to aid in the transfer of electrons from NADH to ubiquinone. Alternative splicing results in multiple transcript variants. There are numerous pseudogenes of this gene on chromosomes 1, 3, 6, 8, 9, 11, 12, and 16. [provided by RefSeq, Apr 2014]'
• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease