NDUFA5 (NM_005000) Human Recombinant Protein
CAT#: TP301539
Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa (NDUFA5), nuclear gene encoding mitochondrial protein
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201539 protein sequence
Red=Cloning site Green=Tags(s) MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLED QLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004991 |
Locus ID | 4698 |
UniProt ID | Q16718, A0A024R745 |
Cytogenetics | 7q31.32 |
Refseq Size | 5602 |
Refseq ORF | 348 |
Synonyms | B13; CI-13kB; CI-13KD-B; NUFM; UQOR13 |
Summary | This nuclear gene encodes a conserved protein that comprises the B13 subunit of complex I of the mitochondrial respiratory chain. The encoded protein localizes to the inner mitochondrial membrane, where it is thought to aid in the transfer of electrons from NADH to ubiquinone. Alternative splicing results in multiple transcript variants. There are numerous pseudogenes of this gene on chromosomes 1, 3, 6, 8, 9, 11, 12, and 16. [provided by RefSeq, Apr 2014] |
Protein Pathways | Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417602 | NDUFA5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY417602 | Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa (NDUFA5), nuclear gene encoding mitochondrial protein |
USD 325.00 |
|
PH301539 | NDUFA5 MS Standard C13 and N15-labeled recombinant protein (NP_004991) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review