TPD52L2 (NM_003288) Human Mass Spec Standard

CAT#: PH301547

TPD52L2 MS Standard C13 and N15-labeled recombinant protein (NP_003279)

Product Images

Coomassie blue staining of purified TPD52L2 protein (Cat# TP301547). The protein was produced from HEK293T cells transfected with TPD52L2 cDNA clone (Cat# RC201547) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201547
• Predicted MW: 22.2 kDa
• Protein Sequence:
  Sequence Link

  >RC201547 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAK
  ERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKT
  SAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003279
• RefSeq Size: 2359
• RefSeq ORF: 618
• Synonyms: D54; TPD54
• Locus ID: 7165
• UniProt ID: O43399, Q6FGS1
• Cytogenetics: 20q13.33
• Summary: 'This gene encodes a member of the tumor protein D52-like family. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. Expression of this gene may be a marker for breast cancer and acute lymphoblastic leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 12. [provided by RefSeq, Aug 2011]'