TPD52L2 (NM_003288) Human Recombinant Protein
CAT#: TP301547
Recombinant protein of human tumor protein D52-like 2 (TPD52L2), transcript variant 5
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201547 protein sequence
Red=Cloning site Green=Tags(s) MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAK ERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKT SAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003279 |
Locus ID | 7165 |
UniProt ID | O43399, Q6FGS1 |
Cytogenetics | 20q13.33 |
Refseq Size | 2359 |
Refseq ORF | 618 |
Synonyms | D54; TPD54 |
Summary | This gene encodes a member of the tumor protein D52-like family. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. Expression of this gene may be a marker for breast cancer and acute lymphoblastic leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 12. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401134 | TPD52L2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404541 | TPD52L2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404543 | TPD52L2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430819 | TPD52L2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430821 | TPD52L2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401134 | Transient overexpression lysate of tumor protein D52-like 2 (TPD52L2), transcript variant 5 |
USD 396.00 |
|
LY404541 | Transient overexpression lysate of tumor protein D52-like 2 (TPD52L2), transcript variant 6 |
USD 396.00 |
|
LY404543 | Transient overexpression lysate of tumor protein D52-like 2 (TPD52L2), transcript variant 2 |
USD 396.00 |
|
LY430819 | Transient overexpression lysate of tumor protein D52-like 2 (TPD52L2), transcript variant 6 |
USD 396.00 |
|
LY430821 | Transient overexpression lysate of tumor protein D52-like 2 (TPD52L2), transcript variant 2 |
USD 396.00 |
|
PH301547 | TPD52L2 MS Standard C13 and N15-labeled recombinant protein (NP_003279) |
USD 2,055.00 |
|
PH319692 | TPD52L2 MS Standard C13 and N15-labeled recombinant protein (NP_955391) |
USD 2,055.00 |
|
TP319692 | Recombinant protein of human tumor protein D52-like 2 (TPD52L2), transcript variant 6 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review