SPOP (NM_001007229) Human Mass Spec Standard
CAT#: PH301551
SPOP MS Standard C13 and N15-labeled recombinant protein (NP_001007230)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201551 |
Predicted MW | 42.1 kDa |
Protein Sequence |
>RC201551 protein sequence
Red=Cloning site Green=Tags(s) MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLR VNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRD FLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQE FQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKY ALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVA EAYRSLASAQCPFLGPPRKRLKQS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001007230 |
RefSeq Size | 2982 |
RefSeq ORF | 1122 |
Synonyms | BTBD32; NEDMACE; NEDMIDF; NSDVS1; NSDVS2; TEF2 |
Locus ID | 8405 |
UniProt ID | O43791 |
Cytogenetics | 17q21.33 |
Summary | This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401186 | SPOP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423451 | SPOP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423453 | SPOP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423454 | SPOP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425207 | SPOP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425209 | SPOP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401186 | Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 2 |
USD 396.00 |
|
LY423451 | Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 1 |
USD 396.00 |
|
LY423453 | Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 4 |
USD 396.00 |
|
LY423454 | Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 6 |
USD 396.00 |
|
LY425207 | Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 1 |
USD 396.00 |
|
LY425209 | Transient overexpression lysate of speckle-type POZ protein (SPOP), transcript variant 4 |
USD 396.00 |
|
TP301551 | Recombinant protein of human speckle-type POZ protein (SPOP), transcript variant 6 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review