SPOP (NM_001007229) Human Recombinant Protein

CAT#: TP301551

Recombinant protein of human speckle-type POZ protein (SPOP), transcript variant 6

Product Images

LOD and LOQ (fmol/ug of total protein) of the PRISM-SRM mass spectrometry assay for the SPOP protein (OriGene TP301551). Figure cited from J Transl Med, PMID: 28810879

• 

  Coomassie blue staining of purified SPOP protein (Cat# TP301551). The protein was produced from HEK293T cells transfected with SPOP cDNA clone (Cat# RC201551) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201551 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLR
  VNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRD
  FLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQE
  FQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKY
  ALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVA
  EAYRSLASAQCPFLGPPRKRLKQS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 42 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: MS digestion standard (PMID: 28810879)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001007230
• Locus ID: 8405
• UniProt ID: O43791
• Cytogenetics: 17q21.33
• Refseq Size: 2982
• Refseq ORF: 1122
• Synonyms: BTBD32; NEDMACE; NEDMIDF; NSDVS1; NSDVS2; TEF2
• Summary: This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]