SH3 containing Grb 2 like 1 protein (SH3GL1) (NM_003025) Human Mass Spec Standard

CAT#: PH301552

SH3GL1 MS Standard C13 and N15-labeled recombinant protein (NP_003016)

Product Images

Coomassie blue staining of purified SH3GL1 protein (Cat# TP301552). The protein was produced from HEK293T cells transfected with SH3GL1 cDNA clone (Cat# RC201552) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201552
• Predicted MW: 41.5 kDa
• Protein Sequence:
  Sequence Link

  >RC201552 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTM
  LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFI
  DPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIE
  QVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTA
  PKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDG
  QSGFFPLSYVEVLVPLPQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003016
• RefSeq Size: 2559
• RefSeq ORF: 1104
• Synonyms: CNSA1; EEN; SH3D2B; SH3P8
• Locus ID: 6455
• UniProt ID: Q99961, Q6FGM0
• Cytogenetics: 19p13.3
• Summary: 'This gene encodes a member of the endophilin family of Src homology 3 domain-containing proteins. The encoded protein is involved in endocytosis and may also play a role in the cell cycle. Overexpression of this gene may play a role in leukemogenesis, and the encoded protein has been implicated in acute myeloid leukemia as a fusion partner of the myeloid-lymphoid leukemia protein. Pseudogenes of this gene are located on the long arm of chromosomes 11 and 17. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]'
• Protein Families: Druggable Genome
• Protein Pathways: Endocytosis