Argininosuccinate Lyase (ASL) (NM_001024943) Human Mass Spec Standard
CAT#: PH301568
ASL MS Standard C13 and N15-labeled recombinant protein (NP_001020114)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201568 |
Predicted MW | 51.7 kDa |
Protein Sequence |
>RC201568 protein sequence
Red=Cloning site Green=Tags(s) MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKV AEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELI RTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLG VDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTG SSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVI STLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLF SGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001020114 |
RefSeq Size | 2061 |
RefSeq ORF | 1392 |
Synonyms | ASAL |
Locus ID | 435 |
UniProt ID | P04424, A0A024RDL8 |
Cytogenetics | 7q11.21 |
Summary | 'This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]' |
Protein Pathways | Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Metabolic pathways |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422562 | ASL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC422563 | ASL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC422564 | ASL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC424953 | ASL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LY422562 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 1 |
USD 325.00 |
|
LY422563 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 3 |
USD 495.00 |
|
LY422564 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 4 |
USD 495.00 |
|
LY424953 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 2 |
USD 495.00 |
|
PH317527 | ASL MS Standard C13 and N15-labeled recombinant protein (NP_000039) |
USD 2,055.00 |
|
TP301568 | Recombinant protein of human argininosuccinate lyase (ASL), transcript variant 1 |
USD 867.00 |
|
TP317527 | Recombinant protein of human argininosuccinate lyase (ASL), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review