Argininosuccinate Lyase (ASL) (NM_000048) Human Mass Spec Standard
CAT#: PH317527
ASL MS Standard C13 and N15-labeled recombinant protein (NP_000039)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC217527 |
| Predicted MW | 51.5 kDa |
| Protein Sequence |
>RC217527 representing NM_000048
Red=Cloning site Green=Tags(s) MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKV AEEWAQGTFKLNSNDEDIHTANERRLKELIGATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELI RTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLG VDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTG SSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVI STLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLF SGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000039 |
| RefSeq Size | 1937 |
| RefSeq ORF | 1392 |
| Synonyms | ASAL |
| Locus ID | 435 |
| UniProt ID | P04424, A0A024RDL8 |
| Cytogenetics | 7q11.21 |
| Summary | 'This gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]' |
| Protein Pathways | Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Metabolic pathways |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422562 | ASL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC422563 | ASL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC422564 | ASL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC424953 | ASL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LY422562 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 1 |
USD 436.00 |
|
| LY422563 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 3 |
USD 665.00 |
|
| LY422564 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 4 |
USD 665.00 |
|
| LY424953 | Transient overexpression lysate of argininosuccinate lyase (ASL), transcript variant 2 |
USD 665.00 |
|
| PH301568 | ASL MS Standard C13 and N15-labeled recombinant protein (NP_001020114) |
USD 2,055.00 |
|
| TP301568 | Recombinant protein of human argininosuccinate lyase (ASL), transcript variant 1 |
USD 867.00 |
|
| TP317527 | Recombinant protein of human argininosuccinate lyase (ASL), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China