Heat Shock Factor 2 Binding Protein (HSF2BP) (NM_007031) Human Mass Spec Standard

CAT#: PH301580

HSF2BP MS Standard C13 and N15-labeled recombinant protein (NP_008962)

Product Images

Coomassie blue staining of purified HSF2BP protein (Cat# TP301580). The protein was produced from HEK293T cells transfected with HSF2BP cDNA clone (Cat# RC201580) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201580
• Predicted MW: 37.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201580 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGEAGAAEEACRHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVEKNLERKEQE
  LEQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEV
  VKAILGGDKALKFFSITGQTMESFVKSLDGDVQELDSDESQFVFALAGIVTNVAAIACGREFLVNSSRVL
  LDTILQLLGDLKPGQCTKLKVLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQ
  SVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_008962
• RefSeq Size: 1916
• RefSeq ORF: 1002
• Synonyms: heat shock factor 2 binding protein; heat shock transcription factor 2 binding protein
• Locus ID: 11077
• UniProt ID: O75031, Q6IAT7
• Cytogenetics: 21q22.3
• Summary: HSF2 binding protein (HSF2BP) associates with HSF2. The interaction occurs between the trimerization domain of HSF2 and the amino terminal hydrophilic region of HSF2BP that comprises two leucine zipper motifs. HSF2BP may therefore be involved in modulating HSF2 activation. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors