Heat Shock Factor 2 Binding Protein (HSF2BP) (NM_007031) Human Recombinant Protein

CAT#: TP301580

Recombinant protein of human heat shock transcription factor 2 binding protein (HSF2BP)

Product Images

Coomassie blue staining of purified HSF2BP protein (Cat# TP301580). The protein was produced from HEK293T cells transfected with HSF2BP cDNA clone (Cat# RC201580) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201580 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGEAGAAEEACRHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVEKNLERKEQE
  LEQLKMDCEHFKARLETVQADNIREKKEKLALRQQLNEAKQQLLQQAEYCTEMGAAACTLLWGVSSSEEV
  VKAILGGDKALKFFSITGQTMESFVKSLDGDVQELDSDESQFVFALAGIVTNVAAIACGREFLVNSSRVL
  LDTILQLLGDLKPGQCTKLKVLMLMSLYNVSINLKGLKYISESPGFIPLLWWLLSDPDAEVCLHVLRLVQ
  SVVLEPEVFSKSASEFRSSLPLQRILAMSKSRNPRLQTAAQELLEDLRTLEHNV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 37.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_008962
• Locus ID: 11077
• UniProt ID: O75031, Q6IAT7
• Cytogenetics: 21q22.3
• Refseq Size: 1916
• Refseq ORF: 1002
• Synonyms: MEILB2; POF19
• Summary: HSF2 binding protein (HSF2BP) associates with HSF2. The interaction occurs between the trimerization domain of HSF2 and the amino terminal hydrophilic region of HSF2BP that comprises two leucine zipper motifs. HSF2BP may therefore be involved in modulating HSF2 activation. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors