FKBP2 (NM_057092) Human Mass Spec Standard

CAT#: PH301608

FKBP2 MS Standard C13 and N15-labeled recombinant protein (NP_476433)

Product Images

Coomassie blue staining of purified FKBP2 protein (Cat# TP301608). The protein was produced from HEK293T cells transfected with FKBP2 cDNA clone (Cat# RC201608) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201608
• Predicted MW: 15.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201608 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSL
  PQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRT
  EL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_476433
• RefSeq Size: 653
• RefSeq ORF: 426
• Synonyms: FKBP-13; FKBP13; PPIase
• Locus ID: 2286
• UniProt ID: P26885, Q53XJ5
• Cytogenetics: 11q13.1
• Summary: 'The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Sep 2008]'
• Protein Families: Druggable Genome