PPP1R7 (NM_002712) Human Mass Spec Standard

CAT#: PH301634

PPP1R7 MS Standard C13 and N15-labeled recombinant protein (NP_002703)

Product Images

Coomassie blue staining of purified PPP1R7 protein (Cat# TP301634). The protein was produced from HEK293T cells transfected with PPP1R7 cDNA clone (Cat# RC201634) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201634
• Predicted MW: 41.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201634 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPEEEHELPVDME
  TINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEA
  LTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNL
  ESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLD
  IASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSV
  RQIDATFVRF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002703
• RefSeq Size: 2761
• RefSeq ORF: 1080
• Synonyms: SDS22
• Locus ID: 5510
• UniProt ID: Q15435, A0A140VK83
• Cytogenetics: 2q37.3
• Summary: 'This gene encodes a protein subunit that regulates the activity of the serine/threonine phosphatase, protein phosphatase-1. The encoded protein is required for completion of the mitotic cycle and for targeting protein phosphatase-1 to mitotic kinetochores. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]'
• Protein Families: Druggable Genome, Phosphatase