PPP1R7 (NM_002712) Human Recombinant Protein

CAT#: TP301634

Recombinant protein of human protein phosphatase 1, regulatory (inhibitor) subunit 7 (PPP1R7)

Product Images

Coomassie blue staining of purified PPP1R7 protein (Cat# TP301634). The protein was produced from HEK293T cells transfected with PPP1R7 cDNA clone (Cat# RC201634) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201634 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPEEEHELPVDME
  TINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEA
  LTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNL
  ESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLD
  IASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSV
  RQIDATFVRF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 41.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002703
• Locus ID: 5510
• UniProt ID: Q15435, A0A140VK83
• Cytogenetics: 2q37.3
• Refseq Size: 2761
• Refseq ORF: 1080
• Synonyms: SDS22
• Summary: This gene encodes a protein subunit that regulates the activity of the serine/threonine phosphatase, protein phosphatase-1. The encoded protein is required for completion of the mitotic cycle and for targeting protein phosphatase-1 to mitotic kinetochores. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]
• Protein Families: Druggable Genome, Phosphatase