SF2 (SRSF1) (NM_006924) Human Mass Spec Standard
CAT#: PH301636
SFRS1 MS Standard C13 and N15-labeled recombinant protein (NP_008855)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201636 |
| Predicted MW | 27.7 kDa |
| Protein Sequence |
>RC201636 protein sequence
Red=Cloning site Green=Tags(s) MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDA VYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDH MREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR SRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_008855 |
| RefSeq Size | 5468 |
| RefSeq ORF | 744 |
| Synonyms | ASF; SF2; SF2p33; SFRS1; SRp30a |
| Locus ID | 6426 |
| UniProt ID | Q07955 |
| Cytogenetics | 17q22 |
| Summary | 'This gene encodes a member of the arginine/serine-rich splicing factor protein family. The encoded protein can either activate or repress splicing, depending on its phosphorylation state and its interaction partners. Multiple transcript variants have been found for this gene. There is a pseudogene of this gene on chromosome 13. [provided by RefSeq, Jun 2014]' |
| Protein Families | Stem cell - Pluripotency |
| Protein Pathways | Spliceosome |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402060 | SRSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC421492 | SRSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425877 | SRSF1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY402060 | Transient overexpression lysate of splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 1 |
USD 436.00 |
|
| LY421492 | Transient overexpression lysate of splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 2 |
USD 436.00 |
|
| LY425877 | Transient overexpression lysate of splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 2 |
USD 396.00 |
|
| TP301636 | Recombinant protein of human splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 1 |
USD 823.00 |
|
| TP761870 | Purified recombinant protein of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China