SF2 (SRSF1) (NM_006924) Human Mass Spec Standard

CAT#: PH301636

SFRS1 MS Standard C13 and N15-labeled recombinant protein (NP_008855)

Product Images

Coomassie blue staining of purified SRSF1 protein (Cat# TP301636). The protein was produced from HEK293T cells transfected with SRSF1 cDNA clone (Cat# RC201636) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201636
• Predicted MW: 27.7 kDa
• Protein Sequence:
  Sequence Link

  >RC201636 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDA
  VYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDH
  MREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR
  SRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_008855
• RefSeq Size: 5468
• RefSeq ORF: 744
• Synonyms: ASF; SF2; SF2p33; SFRS1; SRp30a
• Locus ID: 6426
• UniProt ID: Q07955
• Cytogenetics: 17q22
• Summary: 'This gene encodes a member of the arginine/serine-rich splicing factor protein family. The encoded protein can either activate or repress splicing, depending on its phosphorylation state and its interaction partners. Multiple transcript variants have been found for this gene. There is a pseudogene of this gene on chromosome 13. [provided by RefSeq, Jun 2014]'
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Spliceosome