SF2 (SRSF1) (NM_006924) Human Recombinant Protein

CAT#: TP301636

Recombinant protein of human splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 1

Product Images

Coomassie blue staining of purified SRSF1 protein (Cat# TP301636). The protein was produced from HEK293T cells transfected with SRSF1 cDNA clone (Cat# RC201636) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201636 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDA
  VYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDH
  MREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR
  SRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_008855
• Locus ID: 6426
• UniProt ID: Q07955
• Cytogenetics: 17q22
• Refseq Size: 5468
• Refseq ORF: 744
• Synonyms: ASF; SF2; SF2p33; SFRS1; SRp30a
• Summary: This gene encodes a member of the arginine/serine-rich splicing factor protein family. The encoded protein can either activate or repress splicing, depending on its phosphorylation state and its interaction partners. Multiple transcript variants have been found for this gene. There is a pseudogene of this gene on chromosome 13. [provided by RefSeq, Jun 2014]
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Spliceosome