Lysosomal acid lipase (LIPA) (NM_000235) Human Mass Spec Standard

CAT#: PH301637

LIPA MS Standard C13 and N15-labeled recombinant protein (NP_000226)

Product Images

Coomassie blue staining of purified LIPA protein (Cat# TP301637). The protein was produced from HEK293T cells transfected with LIPA cDNA clone (Cat# RC201637) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201637
• Predicted MW: 45.4 kDa
• Protein Sequence:
  Sequence Link

  >RC201637 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKMRFLGLVVCLVLWPLHSEGSGGKLTALDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGR
  KNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFW
  AFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCT
  SPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVY
  TTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADV
  YDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000226
• RefSeq Size: 2775
• RefSeq ORF: 1197
• Synonyms: CESD; LAL
• Locus ID: 3988
• UniProt ID: P38571
• Cytogenetics: 10q23.31
• Summary: 'This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase). This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2014]'
• Protein Families: Druggable Genome
• Protein Pathways: Lysosome, Steroid biosynthesis