Lysosomal acid lipase (LIPA) (NM_000235) Human Recombinant Protein
CAT#: TP301637
Recombinant protein of human lipase A, lysosomal acid, cholesterol esterase (LIPA), transcript variant 2
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201637 protein sequence
Red=Cloning site Green=Tags(s) MKMRFLGLVVCLVLWPLHSEGSGGKLTALDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGR KNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFW AFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCT SPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVY TTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADV YDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000226 |
Locus ID | 3988 |
UniProt ID | P38571 |
Cytogenetics | 10q23.31 |
Refseq Size | 2775 |
Refseq ORF | 1197 |
Synonyms | CESD; LAL |
Summary | This gene encodes lipase A, the lysosomal acid lipase (also known as cholesterol ester hydrolase). This enzyme functions in the lysosome to catalyze the hydrolysis of cholesteryl esters and triglycerides. Mutations in this gene can result in Wolman disease and cholesteryl ester storage disease. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2014] |
Protein Families | Druggable Genome |
Protein Pathways | Lysosome, Steroid biosynthesis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424848 | LIPA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC426820 | LIPA HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY424848 | Transient overexpression lysate of lipase A, lysosomal acid, cholesterol esterase (LIPA), transcript variant 2 |
USD 325.00 |
|
LY426820 | Transient overexpression lysate of lipase A, lysosomal acid, cholesterol esterase (LIPA), transcript variant 1 |
USD 325.00 |
|
PH301637 | LIPA MS Standard C13 and N15-labeled recombinant protein (NP_000226) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review