CAPZA1 (NM_006135) Human Mass Spec Standard

CAT#: PH301642

CAPZA1 MS Standard C13 and N15-labeled recombinant protein (NP_006126)

Product Images

Coomassie blue staining of purified CAPZA1 protein (Cat# TP301642). The protein was produced from HEK293T cells transfected with CAPZA1 cDNA clone (Cat# RC201642) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201642
• Predicted MW: 32.9 kDa
• Protein Sequence:
  Sequence Link

  >RC201642 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGY
  EDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGF
  CTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHK
  DVQDSLTVSNEAQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIG
  KEMQNA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006126
• RefSeq Size: 2758
• RefSeq ORF: 858
• Synonyms: CAPPA1; CAPZ; CAZ1
• Locus ID: 829
• UniProt ID: P52907
• Cytogenetics: 1p13.2
• Summary: 'CAPZA1 is a member of the F-actin capping protein alpha subunit family. This gene encodes the alpha subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. [provided by RefSeq, Jul 2008]'